DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and bud23

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001076348.1 Gene:bud23 / 572367 ZFINID:ZDB-GENE-070410-68 Length:282 Species:Danio rerio


Alignment Length:176 Identity:36/176 - (20%)
Similarity:58/176 - (32%) Gaps:71/176 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ANTYFDEYENLEIHELM------LKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAK 60
            |..|......:||...|      |.:.|..:..|              ::|||.|:|:...:.::
Zfish    23 AKKYSQNSRMIEIQTQMSERAVELLNLPEDQPCY--------------LLDVGCGSGLSGDYLSE 73

  Fly    61 AGARLVYAVEASNVATKVALD-------LIEDNG---------------------LTNVVKVIQS 97
            ||...| .|:.|.....|||:       |:.|.|                     |.|..|...|
Zfish    74 AGHYWV-GVDISTAMLDVALEREVEGDLLLGDMGEGMPFRPGMFDGCISISALQWLCNADKKTHS 137

  Fly    98 ---RVEEF-----------------VLPAEAEKVDIIVSEWM--GF 121
               |:..|                 :.|..:|::::|.::.|  ||
Zfish   138 PPKRLYRFFSTLYSSLARGARAVFQIYPENSEQLELITAQAMKAGF 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 36/176 (20%)
Methyltransf_18 40..147 CDD:289607 28/132 (21%)
bud23NP_001076348.1 Methyltransf_11 58..133 CDD:285453 18/75 (24%)
WBS_methylT 204..280 CDD:289366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.