DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and PRMT8

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_062828.3 Gene:PRMT8 / 56341 HGNCID:5188 Length:394 Species:Homo sapiens


Alignment Length:313 Identity:113/313 - (36%)
Similarity:170/313 - (54%) Gaps:20/313 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            |||.|.:..|||.||||..|...|.|::..||.:||||:|:|||:||||||.|.|||||:.|:.:
Human    76 YFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGI 140

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            |.|:: :..:..:|:.|.|.|::.:.:.:|||..||  .||||||:|||||:.|.:|.||::|:.
Human   141 ECSSI-SDYSEKIIKANHLDNIITIFKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIF 202

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD----WHNVDGIKMDTFARKLRTQKSSRPEITQL 195
            ||||:||.|||:||....::|.........|.    |.||.|..|..    :|......|.:..:
Human   203 ARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTC----IRDVAMKEPLVDIV 263

  Fly   196 NPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNH--QGFCIWFDVQFP--GEDFVLS 256
            :|:.::....:...:::..|:..:|   .|......|...|.  .....:|:::|.  .:....|
Human   264 DPKQVVTNACLIKEVDIYTVKTEEL---SFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFS 325

  Fly   257 TSPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADMRKYNLEVDL 309
            |:|.:|.|||||.|..|  |....:.....|...|:||.:|.::|..:..|||
Human   326 TAPDAPYTHWKQTVFYL--EDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDL 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 90/244 (37%)
Methyltransf_18 40..147 CDD:289607 56/106 (53%)
PRMT8NP_062828.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..40
SH3-binding 1. /evidence=ECO:0000269|PubMed:17925405 29..42
SH3-binding 2. /evidence=ECO:0000269|PubMed:17925405 53..58
AdoMet_MTases 115..215 CDD:100107 53/102 (52%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000305|PubMed:26529540, ECO:0000305|PubMed:26876602, ECO:0007744|PDB:4X41, ECO:0007744|PDB:5DST 119..122 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.