DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and LOC556054

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_003200481.1 Gene:LOC556054 / 556054 -ID:- Length:410 Species:Danio rerio


Alignment Length:319 Identity:110/319 - (34%)
Similarity:172/319 - (53%) Gaps:32/319 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            |||.|.:..|||.||||..|...|.|::..||.:||||||:|||:||||||.|.|||||:.||.:
Zfish    92 YFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSMFAAKAGAKHVYGI 156

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            |.|:: ::.:..:|:.|.|.:|:.:.:.:|||..||  .::||||:|||||:.|.:|.||::|:.
Zfish   157 ECSSI-SEYSEKIIKANHLDSVITIFKGKVEETELP--VDQVDIIISEWMGYCLFYESMLNTVIY 218

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD----WHNVDGIKMDTFARKLRTQKSSRPEITQL 195
            ||||:||.|||:||....::|.........|.    |.||.|..|..    :|......|.:..:
Zfish   219 ARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTC----IRNVAMKEPLVDIV 279

  Fly   196 NPQDLLHEGVVFHWMNLLDVEASDLD-------SIQFKEVITAQKAGNHQGFCIWFDVQFP--GE 251
            :.:.::....:...:::..|:..:|.       .||..:.|.|        ...:|:::|.  .:
Zfish   280 DSKQVVSNSCLIKEVDIYTVKPEELSFTSSFCLQIQRNDYIHA--------LVTYFNIEFTKCHK 336

  Fly   252 DFVLSTSPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADMR--KYNLEVD 308
            ....||:|.:|.|||||.|..|  |....::....|...::||.:..::|  .:..|:|
Zfish   337 KTGFSTAPDAPFTHWKQTVFYL--EEYLTVKRGEEIVGTVSMKPNEKNVRDLDFTFELD 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 90/249 (36%)
Methyltransf_18 40..147 CDD:289607 56/106 (53%)
LOC556054XP_003200481.1 AdoMet_MTases 131..231 CDD:100107 52/102 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.