DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and PRMT6

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_060607.2 Gene:PRMT6 / 55170 HGNCID:18241 Length:375 Species:Homo sapiens


Alignment Length:323 Identity:126/323 - (39%)
Similarity:174/323 - (53%) Gaps:42/323 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            |::.|.::.:||.|:.||.|.:||...||.|....:.|.|:||||||||||.|||:||||.||||
Human    47 YYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAV 111

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            |||.: .:.|.:::..|||.:.|.|:...||...||   |:||.|||||||:.||||.||.|||.
Human   112 EASAI-WQQAREVVRFNGLEDRVHVLPGPVETVELP---EQVDAIVSEWMGYGLLHESMLSSVLH 172

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDDW-----------HNVDGIKMDTFARKLRTQKSS 188
            ||.|:|||||||.|:...:|:||.|...|  :|           :.||...::.||.:.....| 
Human   173 ARTKWLKEGGLLLPASAELFIAPISDQML--EWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHS- 234

  Fly   189 RPEITQLNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQ----------GFCIW 243
                 ::..|.|..|.|:........:|   |.....::.:.|...|..:          ||.||
Human   235 -----EIVVQGLSGEDVLARPQRFAQLE---LSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIW 291

  Fly   244 FDVQFPG----EDFVLSTSPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADMRK 302
            |.|.|||    :..||||||..|.|||||.::.|.|.  ..:|:.:.::.:||:..|..:.|:
Human   292 FQVTFPGGESEKPLVLSTSPFHPATHWKQALLYLNEP--VQVEQDTDVSGEITLLPSRDNPRR 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 101/259 (39%)
Methyltransf_18 40..147 CDD:289607 64/106 (60%)
PRMT6NP_060607.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
AdoMet_MTases 67..>200 CDD:418430 75/136 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H10024
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1503
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D387140at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106082
Panther 1 1.100 - - LDO PTHR11006
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5237
SonicParanoid 1 1.000 - - X4197
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.