DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and prmt3

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001017655.1 Gene:prmt3 / 550348 ZFINID:ZDB-GENE-041105-1 Length:512 Species:Danio rerio


Alignment Length:319 Identity:122/319 - (38%)
Similarity:177/319 - (55%) Gaps:47/319 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            ||..|.:..|||.||||:.|.|:|.:.:..|.|:||||:|:|||.||||||.|.|||||:.|.||
Zfish   201 YFSSYGHYSIHEEMLKDKVRTESYRDFMYRNMDVFKDKVVLDVGCGTGILSMFAAKAGAKKVVAV 265

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            :.|.:..: |:|::..|.|.:.:.:|:.|:||..||  .||||||:|||||::||...||||||.
Zfish   266 DQSEIIYQ-AMDIVRSNNLEDTITLIKGRIEEIDLP--VEKVDIIISEWMGYFLLFGSMLDSVLY 327

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD----WHNVDGIKMDTFARKLRTQKSSRPE--IT 193
            |||::|.:.||:||..|:|.:|........:|    |.:|.|.||...      :|:..||  :.
Zfish   328 ARDRYLADDGLVFPDRCSISLAAVGDTQKHNDRIAFWEDVYGFKMTCM------KKAVIPEAVVE 386

  Fly   194 QLNPQDLLHEGVVFHWMNLLDVEASDLD-SIQFKEVITAQKAGNHQGFCI----WFDVQFP---G 250
            .|.|:.::.|..|...::...|..|:|: |:.|...|||      ..||.    :||:.|.   |
Zfish   387 VLKPETVISESAVIKTIDCGSVSVSELEFSVDFILKITA------SSFCTAIVGYFDIFFHKSCG 445

  Fly   251 EDFVLSTSPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQ--------ITMKRSAADMR 301
            ...:.||:|....|||||.|.:|          :||:|.:        |:::::..|.|
Zfish   446 NKVMFSTAPNCTKTHWKQTVFLL----------ESPVAVKAGEDLPGHISVRKNRKDPR 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 102/249 (41%)
Methyltransf_18 40..147 CDD:289607 58/106 (55%)
prmt3NP_001017655.1 zf-C2H2_2 39..>86 CDD:289522
Methyltransf_18 236..340 CDD:289607 58/106 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.