DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Prmt2

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001020315.1 Gene:Prmt2 / 499420 RGDID:1565519 Length:445 Species:Rattus norvegicus


Alignment Length:286 Identity:115/286 - (40%)
Similarity:163/286 - (56%) Gaps:23/286 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCA-KAGARLVYA 68
            |||.|..|::|..||.|:||...|::.||.||:..|||:::|||.||||:|.||| .|..:.|||
  Rat   114 YFDSYGTLKLHLEMLADQPRTTKYHSVILQNKESLKDKVILDVGCGTGIISLFCAHHARPKAVYA 178

  Fly    69 VEASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVL 133
            ||||::|.... .|:..||..:.:.|.|.:||:.|||   ||||::||||||..||.|.|::|:|
  Rat   179 VEASDMAQHTG-QLVLQNGFADTITVFQQKVEDVVLP---EKVDVLVSEWMGTCLLFEFMIESIL 239

  Fly   134 LARDKFLKEGGLLFPSECTIFVAPCSVPS------LFDDWHNVDGIKMDTFARKLRTQKSSRPEI 192
            .|||.:|||.|:::|:...:.:.|||...      ||  |.|.....:.........:..|||:.
  Rat   240 YARDAWLKEDGIIWPTTAALHLVPCSAEKDYHSKVLF--WDNAYEFNLSALKSLAIKEFFSRPKS 302

  Fly   193 TQ-LNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQGFCIWFDVQF-------P 249
            .. |.|:|.|.|......:::..|:.|||::::.:.....||||...||..||.|.|       |
  Rat   303 NHILKPEDCLSEPCTILQLDMRTVQVSDLETMRGELRFDIQKAGTLHGFTAWFSVHFQSLEEGQP 367

  Fly   250 GEDFVLSTSPLSPPTHWKQCVVVLPE 275
            .:  ||||.||.|.|||||.:.::.:
  Rat   368 QQ--VLSTGPLHPTTHWKQTLFMMDD 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 98/246 (40%)
Methyltransf_18 40..147 CDD:289607 56/107 (52%)
Prmt2NP_001020315.1 SH3_PRMT2 46..98 CDD:212740
AdoMet_MTases 153..253 CDD:100107 53/103 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352452
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D387140at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.