DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and prmt1

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_012821800.1 Gene:prmt1 / 448086 XenbaseID:XB-GENE-484022 Length:369 Species:Xenopus tropicalis


Alignment Length:323 Identity:115/323 - (35%)
Similarity:171/323 - (52%) Gaps:40/323 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            |||.|.:..|||.||||..|...|.|::..|:.|||||:|:|||:|||||..|.|||||:.|..:
 Frog    51 YFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGI 115

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            |.|:: :..|:.:::.|.|.:||.:|:.:|||..||  .||||||:|||||:.|.:|.||::|:.
 Frog   116 ECSSI-SDYAIKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVIY 177

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD----------WHNVDGIKMDTFARKLRTQKSSR 189
            ||||:|...||:||...|::|      :..:|          |.||.|..|..    ::......
 Frog   178 ARDKWLTPDGLIFPDRATLYV------TAIEDRQYKDYKIHWWENVYGFDMSC----IKDVAIKE 232

  Fly   190 PEITQLNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNH--QGFCIWFDVQF---- 248
            |.:..::|:.|:....:...:::..|:..||   .|......|...|.  .....:|:::|    
 Frog   233 PLVDVVDPKQLVTNACLIKEVDIYTVKVDDL---TFTSPFCLQVKRNDYIHALVAYFNIEFTRCH 294

  Fly   249 --PGEDFVLSTSPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADMRKYNLEVDL 309
              .|    .||||.||.|||||.|..:  |....::....|...|:||.:|.:.|..:..||:
 Frog   295 KRTG----FSTSPESPYTHWKQTVFYM--EDYLTVKTGEEIFGTISMKPNAKNNRDLDFTVDI 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 91/250 (36%)
Methyltransf_18 40..147 CDD:289607 55/106 (52%)
prmt1XP_012821800.1 AdoMet_MTases 90..190 CDD:100107 52/102 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.