DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and carm1

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001003645.1 Gene:carm1 / 445251 ZFINID:ZDB-GENE-040724-77 Length:588 Species:Danio rerio


Alignment Length:355 Identity:125/355 - (35%)
Similarity:174/355 - (49%) Gaps:53/355 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            ||..|..|...:.|::|..|...|..|||.|...||||:|:|||.|:||||.|.|:||||.||||
Zfish   123 YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKVVLDVGCGSGILSFFAAQAGARKVYAV 187

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            |||.:|....: |:..|.|:..|.||..:|||..||   |:||||:||.||:.|.:|.||:|.|.
Zfish   188 EASTMAQHAEV-LVNSNRLSERVVVIPGKVEEVSLP---EQVDIIISEPMGYMLFNERMLESYLH 248

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD-------W-----HNVD-----GIKMDTFARKL 182
            |: ||||..|.:||:...:.:||.:...|:.:       |     |.||     |..:|.:.|  
Zfish   249 AK-KFLKPSGKMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFR-- 310

  Fly   183 RTQKSSRPEITQLNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQGFCIWFDVQ 247
                  :|.:...:.:.|:.:.|.: .:|.|:.:..||..|:.........:|...|...||||.
Zfish   311 ------QPIVDTFDIRILMAKSVKY-TVNFLEAKEEDLYKIEIPFKFHMMHSGLVHGLAFWFDVA 368

  Fly   248 FPGEDFV--LSTSPLSPPTHWKQ--CVVVLPEESCENLEEKSPIAFQITMKRSAADM-------- 300
            |.|....  |||:|..|.|||.|  |::..|..:... :..|..|..|..||.:.|:        
Zfish   369 FIGSVMTVWLSTAPTEPLTHWYQVRCLLQSPLFAKAG-DTMSGTALLIANKRQSYDISIVAQVDQ 432

  Fly   301 ---RKYNLEVDLLDP-----NTEEHPVPCS 322
               :..|| :||.:|     .|...|.|.|
Zfish   433 TGSKSSNL-LDLKNPFFRYTGTTPAPPPGS 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 93/255 (36%)
Methyltransf_18 40..147 CDD:289607 58/106 (55%)
carm1NP_001003645.1 CARM1 8..112 CDD:288395
PRMT5 <146..409 CDD:282971 103/277 (37%)
AdoMet_MTases 162..263 CDD:100107 57/105 (54%)
Transactivation domain. /evidence=ECO:0000250 473..588
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.