DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Art9

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_650321.1 Gene:Art9 / 41698 FlyBaseID:FBgn0038188 Length:313 Species:Drosophila melanogaster


Alignment Length:297 Identity:77/297 - (25%)
Similarity:137/297 - (46%) Gaps:41/297 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DEYENL--EIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            |..:||  |:.:.||.|.....||.......:.|||||||:|||..:|:||....:|||..|.|:
  Fly     2 DLEKNLLREMADSMLNDVISTRAYEWVFKRYERLFKDKIVLDVGCRSGLLSLMSVEAGAVKVMAL 66

  Fly    70 ---EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDS 131
               |::...:|..:...::    ::.:.|...:.|.|||...:|||||||||:|..:..:.:...
  Fly    67 GNRESAEFVSKAFIGTEKE----DIFEFIDGDIHEIVLPCGLKKVDIIVSEWVGHSVFVDSLFKE 127

  Fly   132 VLLARDKFLKEGGLLFPSECTIFVAPCSVPSLFDDWHNVDGIKMDTFARKLRTQKSSRPEITQL- 195
            |:.||:|:|.:||.:.|:...:||  |.:..     |....::::..      .:|..|..:.: 
  Fly   128 VIFAREKWLVKGGFIIPNVAQLFV--CGIAD-----HPRKTVEVNIL------PQSDYPGRSYMV 179

  Fly   196 -NPQDLLHEGVV-------FHWMNLLDVEASDLDSIQFKEVITAQKAGNHQ--GFCIWFDVQF-- 248
             .|..|:.:.|.       .:.:..:|:..:.::...|:.....:...:.|  ...::.|:..  
  Fly   180 REPVSLIEDYVAKEQLITEKYLLKTIDLCTAHINDESFRVPFKLRGLRDSQLGAVVLYSDIGLCR 244

  Fly   249 PGEDF--VLSTSPLSPPTHWKQCVVVL--PEE--SCE 279
            |...|  :.||.|..|.|:.:|.::.:  |.|  .||
  Fly   245 PRGKFRLMFSTGPKRPRTYVRQTILFMDNPVEVAKCE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 64/252 (25%)
Methyltransf_18 40..147 CDD:289607 40/109 (37%)
Art9NP_650321.1 AdoMet_MTases 41..143 CDD:100107 36/105 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440088
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.