DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and CG10903

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001262365.1 Gene:CG10903 / 40952 FlyBaseID:FBgn0037543 Length:276 Species:Drosophila melanogaster


Alignment Length:287 Identity:52/287 - (18%)
Similarity:91/287 - (31%) Gaps:121/287 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAVEASNVATKVALDLIEDNGLTNVVKVIQ 96
            :|...|..:.::::|:|.|:|:..:                         ::||           
  Fly    43 LLALPDDDESRLILDIGCGSGLSGS-------------------------VLED----------- 71

  Fly    97 SRVEEFVLPAEAEKVDIIVSE--WMGFYLLHEGMLDSVL---LARDKFLKEGGLLFPSECTIFVA 156
                               ||  |:|.. :.:.|||..:   :|.|..|.:.|...|.:...|..
  Fly    72 -------------------SEHMWIGID-ISKSMLDIAVEREVAGDVILGDMGEGMPFKPGTFDG 116

  Fly   157 PCSVPSLFDDW--------HNVDG--IKMDT--FARKLRTQKSSRPEITQLNPQDLLHEGVVFHW 209
            ..|:.:|  .|        ||...  :|..|  |:...||.::    :.|..|:           
  Fly   117 AISISAL--QWLCNADKSYHNPHKRLLKFFTTLFSCLTRTARA----VFQFYPE----------- 164

  Fly   210 MNLLDVEASDLDSIQFKEVITAQ--KAGNHQGFCIWFDVQFPGED------FVLST-------SP 259
                     :.|.|   |::|:|  |||.:.|..    |.:|...      .||.|       ..
  Fly   165 ---------NSDQI---EMVTSQAMKAGFYGGLV----VDYPNSAKAKKYYLVLMTGGSAELPQA 213

  Fly   260 LSPPTHWKQCVVVLPEESCENLEEKSP 286
            |..|...::...:...::|.....|:|
  Fly   214 LGSPEEERRVNYIKKRDACREARGKAP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 42/230 (18%)
Methyltransf_18 40..147 CDD:289607 17/111 (15%)
CG10903NP_001262365.1 Methyltransf_11 56..142 CDD:285453 24/143 (17%)
WBS_methylT 202..272 CDD:289366 7/39 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.