DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and prmt3

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_988966.1 Gene:prmt3 / 394563 XenbaseID:XB-GENE-946963 Length:519 Species:Xenopus tropicalis


Alignment Length:333 Identity:125/333 - (37%)
Similarity:173/333 - (51%) Gaps:59/333 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            ||..|.:..|||.||||..|.|:|.:.:..|..:||||.|:|||.||||||.|.|||||:.|..|
 Frog   208 YFSSYGHFGIHEEMLKDTVRTESYRDFMYQNPHIFKDKTVLDVGCGTGILSMFAAKAGAKKVIGV 272

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            :.|::..: |:|::..|||.:.|.:::.|||:..||  .||||||:|||||::||.|.|||||:.
 Frog   273 DQSDIIYQ-AMDIVRLNGLEDTVSLVKGRVEDVDLP--VEKVDIIISEWMGYFLLFESMLDSVIC 334

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD---------WHNVDGIKMDTFAR---------- 180
            ||||:|.|.|.::|..||:     |:.:|.|:         |.||.|..|....:          
 Frog   335 ARDKYLNEDGAVYPDTCTM-----SLVALSDETKHAGKIAFWENVYGFNMSCMKKCVIPEAVVEV 394

  Fly   181 -KLRTQKSSRPEITQLNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQGFCIWF 244
             |..||.|....|..:|.|....:.:.|         |||......::......||       :|
 Frog   395 VKAETQISEPSIIKNINCQTATIKDLDF---------ASDFSLSVTRDAPCTALAG-------YF 443

  Fly   245 DVQFPG--EDFV-LSTSPLSPPTHWKQCVVVL----PEESCENLEEKSPIAFQITMKRSAADMRK 302
            ||.|..  |..| .||||....|||||.|.:|    |.::.:.||.:      ||::::..|.| 
 Frog   444 DVCFERSCERAVSFSTSPSCTKTHWKQTVFMLEKPIPAKAGDVLEGR------ITVRKNRKDPR- 501

  Fly   303 YNLEVDLL 310
             :|.:.||
 Frog   502 -SLIITLL 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 98/258 (38%)
Methyltransf_18 40..147 CDD:289607 59/106 (56%)
prmt3NP_988966.1 AdoMet_MTases 246..347 CDD:100107 56/103 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.