DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Art7

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster


Alignment Length:394 Identity:92/394 - (23%)
Similarity:149/394 - (37%) Gaps:108/394 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DEYE-NLEIHEL----MLKDRPRQEAYYNA----ILGNKDLFKDKIVMDVGAGTGILSAFCAKAG 62
            |:|: :||:...    ||.|..|.:.|:.|    |.|.::..::..|:|:|.||||||.....||
  Fly    22 DDYDYHLEVANAGFGDMLHDWERNQKYFAALRKTIAGMREAGREVHVLDIGTGTGILSMMALAAG 86

  Fly    63 ARLVYAVEA----SNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAE-AEKVDIIVSEWMGFY 122
            |..|.|.||    :|.|.|:    :..||..:.|::|:.|..|..:..: ..|.:::|:|.:...
  Fly    87 ADSVTACEAFLPMANCAEKI----LAANGAGDKVRLIRKRSTEIQVGEDMPRKANLLVAELLDTE 147

  Fly   123 LLHEGMLDSVLLARDKFLKEGGLLFPSECTIFVAPCSVPSLFDDWH------NVDG--------- 172
            |:.||.:.....|..:.|.|..|..|:....:......| |...|:      |:||         
  Fly   148 LIGEGAIGIYNHAHAELLTEDALCIPARARCYAQVAQSP-LAAQWNSLKTIANLDGEPLLHPPEQ 211

  Fly   173 -------------------------------IKMDTFARKLRTQKSSRPEITQLNPQDLLHEGVV 206
                                           |....|.||...:| .|.::.:|..:......:|
  Fly   212 LKSCQGEAALHDVQLSQLPSSAFRPLTDPVEIFQFDFQRKQEREK-QRSQLLKLQSKQPGAAELV 275

  Fly   207 FHWMNL-LDVEASDLDSI-------QFKEVITAQKAGNH--QGFCIWFDVQFPGEDFVLSTSPLS 261
            |:|.:: ||.:...|.|.       |.|| :.|:||.:|  .....|.|                
  Fly   276 FYWWDIQLDDDGEILLSCAPYWAHPQLKE-LAAEKAKDHPLPNVVPWRD---------------- 323

  Fly   262 PPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADMRKYNLEVDLLD----PNTEEHPVPCS 322
               ||.|.:..:| :..:.||...  :|.::....     :|:|..|..:    .:...|...|.
  Fly   324 ---HWMQAIYYIP-KPLQLLEAGK--SFHLSCHHD-----EYSLWFDAREEAPTKSVRRHTCTCD 377

  Fly   323 CHMT 326
            .|||
  Fly   378 LHMT 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 75/306 (25%)
Methyltransf_18 40..147 CDD:289607 35/111 (32%)
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 44/153 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440094
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.