DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Carm1

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001025212.1 Gene:Carm1 / 363026 RGDID:1305879 Length:608 Species:Rattus norvegicus


Alignment Length:361 Identity:126/361 - (34%)
Similarity:178/361 - (49%) Gaps:58/361 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            ||..|..|...:.|::|..|...|..|||.|...||||||:|||.|:||||.|.|:||||.:|||
  Rat   150 YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAV 214

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            |||.:|....: |::.|.||:.:.||..:|||..||   |:||||:||.||:.|.:|.||:|.|.
  Rat   215 EASTMAQHAEV-LVKSNNLTDRIVVIPGKVEEVSLP---EQVDIIISEPMGYMLFNERMLESYLH 275

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD-------W-----HNVD-----GIKMDTFARKL 182
            |: |:||..|.:||:...:.:||.:...|:.:       |     |.||     |..:|.:.|  
  Rat   276 AK-KYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFR-- 337

  Fly   183 RTQKSSRPEITQLNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQGFCIWFDVQ 247
                  :|.:...:.:.|:.:.|.: .:|.|:.:..||..|:.........:|...|...||||.
  Rat   338 ------QPVVDTFDIRILMAKSVKY-TVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVA 395

  Fly   248 FPGEDFV--LSTSPLSPPTHWKQ--CVVVLP--EESCENLEEKSPIAFQITMKRSAADM------ 300
            |.|....  |||:|..|.|||.|  |:...|  .::.:.|   |.....|..||.:.|:      
  Rat   396 FIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTL---SGTCLLIANKRQSYDISIVAQV 457

  Fly   301 -----RKYNLEVDLLDP-----NTEEHPVPCSCHMT 326
                 :..|| :||.:|     .|...|.|.| |.|
  Rat   458 DQTGSKSSNL-LDLKNPFFRYTGTTPSPPPGS-HYT 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 92/255 (36%)
Methyltransf_18 40..147 CDD:289607 57/106 (54%)
Carm1NP_001025212.1 CARM1 35..139 CDD:402914
AdoMet_MTases 189..284 CDD:100107 52/99 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.