DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Prmt7

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001014175.1 Gene:Prmt7 / 361402 RGDID:1304869 Length:693 Species:Rattus norvegicus


Alignment Length:386 Identity:93/386 - (24%)
Similarity:151/386 - (39%) Gaps:85/386 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHEL--------MLKDRPRQEAYYNAILGNKDLFKDK----IVMDVGAGTGILSAF 57
            :.:|.|:.:.|:.        ||.|:.|...||..|.......|||    :|:|:|.|||:||..
  Rat    17 WLEEDEHYDYHQEIARSSYADMLHDKDRNIKYYQGIRAAVSRVKDKGQKALVLDIGTGTGLLSMM 81

  Fly    58 CAKAGARLVYAVEASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAE---KVDIIVSEWM 119
            ...|||...||||......:.|:.::|.||.::.:|||.....|..:..:.:   :.:|:|:|..
  Rat    82 AVTAGADFCYAVEVFKPMAEAAVKIVEKNGFSDKIKVINKHSTEVTVGPDGDLPCRANILVTELF 146

  Fly   120 GFYLLHEGMLDSVLLARDKFLKEGGLLFPSECTIFVAPCSVPSLFDDWHNVDGIKMDT-FARKLR 183
            ...|:.||.|.|...|....::|.....|...|::........:: .|:.:..:::.| ...:|.
  Rat   147 DTELIGEGALPSYEHAHKHLVQEDCEAVPHRATVYAQLVESKRMW-SWNKLFPVRVQTGLGEQLI 210

  Fly   184 TQKSSRP-----------EITQLNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKA--- 234
            ...|...           ::.|::|.|         :..|.||  ..:.|:.|.:.:::..|   
  Rat   211 IPPSELERCPGAPSVYDIQLNQVSPAD---------FTVLSDV--LPMFSVDFSKQVSSSAACHS 264

  Fly   235 --------GNHQGFCIWFDVQFPGE--------DFVLSTSP--LSPPTHWKQCVVVLPEESCENL 281
                    |..|....|:|::...|        .|...|.|  |....||.|||..||:|  |.:
  Rat   265 KQFVPLASGQAQVVLSWWDIEMDPEGKIKCTMAPFWAQTDPQELQWRDHWMQCVYFLPQE--EPI 327

  Fly   282 EEKSPIAFQITMKRSAADMRK-----YNLEVDLLDPNTEEHPV--PCSCHMTKCILTEAHL 335
            .:.||        |..|....     |:|:....|.|...:.|  .|.|        :|||
  Rat   328 MQGSP--------RCLAAHHDDYCVWYSLQRTSPDENNSAYQVRPVCDC--------QAHL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 63/276 (23%)
Methyltransf_18 40..147 CDD:289607 36/113 (32%)
Prmt7NP_001014175.1 AdoMet_MTases 37..>188 CDD:302624 45/150 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.