DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and CG10428

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster


Alignment Length:125 Identity:28/125 - (22%)
Similarity:51/125 - (40%) Gaps:40/125 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ELMLKDRPRQEAYYNAIL-----GNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAVEASN-- 73
            |.:.:.|.:.|...||::     |::       ::|..:|||.|:         ::.|::..|  
  Fly   364 ERLERKRQQLENLANAVVSLAQPGDR-------IVDFCSGTGHLA---------ILLALKLPNCT 412

  Fly    74 --VATKVALDLIE------DNGLTNVVKVIQSRVEEFV--------LPAEAEKVDIIVSE 117
              |....|..|::      :.||||.| ..|..::.||        |.|.....||::.:
  Fly   413 IIVMENKAFSLLQAQKRSNELGLTNCV-FYQCNIDYFVGGFKIGASLHACGTATDIVLQQ 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 28/125 (22%)
Methyltransf_18 40..147 CDD:289607 22/96 (23%)
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286
AdoMet_MTases 368..486 CDD:302624 27/121 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.