DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and PRMT2

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001526.2 Gene:PRMT2 / 3275 HGNCID:5186 Length:433 Species:Homo sapiens


Alignment Length:286 Identity:111/286 - (38%)
Similarity:160/286 - (55%) Gaps:23/286 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAK-AGARLVYA 68
            ||..|..|::|..||.|:||...|::.||.||:...||:::|||.||||:|.|||. |..|.|||
Human   102 YFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYA 166

  Fly    69 VEASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVL 133
            ||||.:|.... .|:..||..:::.|.|.:||:.|||   ||||::||||||..||.|.|::|:|
Human   167 VEASEMAQHTG-QLVLQNGFADIITVYQQKVEDVVLP---EKVDVLVSEWMGTCLLFEFMIESIL 227

  Fly   134 LARDKFLKEGGLLFPSECTIFVAPCSVPS------LFDDWHNVDGIKMDTFARKLRTQKSSRPEI 192
            .|||.:|||.|:::|:...:.:.|||...      ||  |.|.....:.........:..|:|:.
Human   228 YARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLF--WDNAYEFNLSALKSLAVKEFFSKPKY 290

  Fly   193 TQ-LNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQGFCIWFDVQF-------P 249
            .. |.|:|.|.|......:::..|:.|||::::.:.....:|||...||..||.|.|       |
Human   291 NHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQP 355

  Fly   250 GEDFVLSTSPLSPPTHWKQCVVVLPE 275
            .:  ||||.|..|.|||||.:.::.:
Human   356 PQ--VLSTGPFHPTTHWKQTLFMMDD 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 95/246 (39%)
Methyltransf_18 40..147 CDD:289607 56/107 (52%)
PRMT2NP_001526.2 Interaction with ESR1 1..277 79/180 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SH3_PRMT2 34..86 CDD:212740
Interaction with RB1. /evidence=ECO:0000250 83..207 51/108 (47%)
AdoMet_MTases 110..>169 CDD:302624 30/58 (52%)
Interaction with ESR1 133..275 65/147 (44%)
AdoMet_MTases 141..241 CDD:100107 54/103 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D387140at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.