DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and CG32152

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster


Alignment Length:322 Identity:87/322 - (27%)
Similarity:145/322 - (45%) Gaps:47/322 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAVEA 71
            |....|::.....||:.....:.:.|...:.|.||:.::.:..|||.|:...|:.||:.||||:.
  Fly   179 DTAARLDVMRNRQKDQAHMYFFQSVIHHQRHLIKDRTILVLCCGTGTLALMAAQMGAKRVYAVDY 243

  Fly    72 SNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLLAR 136
            |.|.....| ::..||...|:.|:..|:::..||.   |||.|:..|||:.||:|..:..||.||
  Fly   244 SKVTGYTTL-VVRQNGYEGVITVMNGRMKDLKLPT---KVDGIICNWMGYCLLYESEILEVLEAR 304

  Fly   137 DKFLKEGGLLFPSECTIFVAPCSVPSLFDD----WHNVDGIKMDTFARKLRTQKSSRPEITQLNP 197
            |::||:||.:.|....:::.......|..:    |.||.|..|:.    :|....:.|.:.....
  Fly   305 DRWLKKGGFILPDLAALYLVASEEHKLKSERCNHWRNVYGFNMNA----IRRYALAEPCVALTTG 365

  Fly   198 QDLLHEGVVFHWMNLLDVEASDLDSIQFKEVI--TAQKAGNHQGFCIWFDVQFPGE-DFVLSTSP 259
            :.||   .:.|.:..||::.:..:.:.....|  :..:.|..:.|.::|:|||... :|.||.:|
  Fly   366 KKLL---TMAHCVLRLDLKRARREDLFIDRNIRLSVNREGYLECFLLFFEVQFSNSLNFKLSCNP 427

  Fly   260 -LSPP--THWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADMRKY-----NLEVDLLDPN 313
             |..|  :.|.|.|:.:          :.|..           |||.     ||:...|.||
  Fly   428 CLKSPFKSLWMQSVLFV----------EQPFV-----------MRKNIHYTGNLKFKTLKPN 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 65/242 (27%)
Methyltransf_18 40..147 CDD:289607 42/106 (40%)
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 40/103 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440089
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.