DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Mettl7a

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001032432.1 Gene:Mettl7a / 315306 RGDID:1308407 Length:244 Species:Rattus norvegicus


Alignment Length:247 Identity:43/247 - (17%)
Similarity:79/247 - (31%) Gaps:109/247 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VMDVGAGTGILSAFCAKAGARLVYAVEASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEA 108
            :::||.|||....| ...|.|:.               .|:.|          ...|:|:..:.|
  Rat    74 LLEVGCGTGANFKF-YPPGCRVT---------------CIDPN----------PNFEKFLFKSVA 112

  Fly   109 EKVDI-----IVSEWMGFYLLHEGMLDSVLLARDKFLKEGGLLFPSECTIFVAPCSVPSLFDDWH 168
            |...:     :|:.....:.:.:|.:|.|:                 ||:.:  |||        
  Rat   113 ENRHLQFERFLVAVGEDMHQVADGSVDVVV-----------------CTLVL--CSV-------- 150

  Fly   169 NVDGIKMDTFARKLRTQKSSRPEITQLNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQK 233
                          ::|:....|:.:     :|..|..|::|..:..|.|..:.. :::|:..  
  Rat   151 --------------KSQEKILREVCR-----VLRPGGAFYFMEHVADERSTWNYF-WQQVLDP-- 193

  Fly   234 AGNHQGFCIWFDVQFPGEDFVLSTSPLSPPTHWKQCVVVLPEESCENLEEKS 285
                    :||.| |.|.:                    |..||.:.||:.|
  Rat   194 --------VWFLV-FDGCN--------------------LTRESWKTLEQAS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 32/204 (16%)
Methyltransf_18 40..147 CDD:289607 18/107 (17%)
Mettl7aNP_001032432.1 Methyltransf_11 75..172 CDD:400514 28/168 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.