DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Prmt6

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001380787.1 Gene:Prmt6 / 295384 RGDID:1304701 Length:375 Species:Rattus norvegicus


Alignment Length:323 Identity:129/323 - (39%)
Similarity:174/323 - (53%) Gaps:42/323 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            |::.|.::.:||.|:.||.|.:||...||.|....:.|.|:||||||||||.|||:||||.||||
  Rat    47 YYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAV 111

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            |||.: .:.|.:::..|||.:.|.::...||...||   |:||.|||||||:.||||.||.|||.
  Rat   112 EASAI-WQQAQEVVRLNGLEDRVHILPGPVETVELP---EQVDAIVSEWMGYGLLHESMLSSVLH 172

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDDW-----------HNVDGIKMDTFARKLRTQKSS 188
            ||.|:|||||||.|....:||||.|...|  :|           :.||...|::||.:.....| 
  Rat   173 ARTKWLKEGGLLLPDSAELFVAPISDQML--EWRLGFWSQVKQHYGVDMSCMESFATRCLMGHS- 234

  Fly   189 RPEITQLNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQ----------GFCIW 243
                 ::..|.|..|.|:........:|   |.....::.:.|...|..:          ||.||
  Rat   235 -----EIVVQGLSGEDVLARPQRFAQLE---LARAGLEQELEAGVGGRFRCSCYGSAPLHGFAIW 291

  Fly   244 FDVQFPGED----FVLSTSPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADMRK 302
            |.|.|||.|    .||||||..|.|||||.::.|.|.  ..:|:.:.|:.:||:..|..:.|:
  Rat   292 FQVTFPGGDSEKPLVLSTSPFHPATHWKQALLYLNEP--VPVEQDTDISGEITLLPSRDNPRR 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 102/259 (39%)
Methyltransf_18 40..147 CDD:289607 63/106 (59%)
Prmt6NP_001380787.1 AdoMet_MTases 85..185 CDD:100107 62/103 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H10024
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D387140at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106082
Panther 1 1.100 - - LDO PTHR11006
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4197
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.