DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Prmt9

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001178528.1 Gene:Prmt9 / 291947 RGDID:1306157 Length:841 Species:Rattus norvegicus


Alignment Length:327 Identity:84/327 - (25%)
Similarity:144/327 - (44%) Gaps:60/327 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 HELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAVEASNVATKVA 79
            |.:||.|..|.| .|||.:........|.|:|:||||||||.|..||||..|||.|.|....::|
  Rat   153 HFIMLNDTKRNE-IYNAAIQKAVRLGSKTVLDIGAGTGILSMFAKKAGAHSVYACELSKTMYELA 216

  Fly    80 LDLIEDNGLTNVVKVIQSRVEEFVLPAE-AEKVDIIVSEWMGFYLLHEGMLDSVLLARDKFLKEG 143
            .|::..|.:.:.::::..:..:..:|.. .|:|.::|:|.:...:..||:::|::.|.:..|.:.
  Rat   217 CDVVAANKMEDGIRLLHMKSLDLEIPKHIPERVSLVVTETVDAGVFGEGIVESLIHAWEHLLLQP 281

  Fly   144 ------------GLLFPSECTI--FVAPCSVPSLFDDWHNVD-----GIKMDTFARKLRTQKSSR 189
                        |.:.|:...|  ....|:.   ....|.|.     ||.:.|   .:|.|.   
  Rat   282 QTKGESGSWGKYGKVIPASAVISGMAVECAE---IRRHHRVSAKDIAGIHLPT---NVRFQS--- 337

  Fly   190 PEITQLNPQDLLH-------EGV------VFHWMNLLDVEASDLDSIQFKEVIT---------AQ 232
            |....::|::.:.       .|:      :.....::.|:.::|.  :.|.:.|         |.
  Rat   338 PAYASVDPEETVEPYTTEKMSGIPGGYRPLTECFQIMKVDFNNLQ--ELKSLATRKPHSLSVPAV 400

  Fly   233 KAGNHQGFCIWFDVQFPGEDFVLSTSPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSA 297
            |.|......:||.:|. .::..||||| |..|.|:|  .|.|.::.|:...:.  ..|:||:.|.
  Rat   401 KEGTLDAIMVWFVLQL-DDEHSLSTSP-SEETCWEQ--AVYPVQALEDYWIQP--GDQVTMEASC 459

  Fly   298 AD 299
            .|
  Rat   460 HD 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 64/270 (24%)
Methyltransf_18 40..147 CDD:289607 35/119 (29%)
Prmt9NP_001178528.1 TPR_11 68..132 CDD:290150
TPR repeat 68..95 CDD:276809
TPR repeat 100..130 CDD:276809
AdoMet_MTases 148..>338 CDD:302624 54/194 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.