DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Prmt7

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_663379.1 Gene:Prmt7 / 214572 MGIID:2384879 Length:692 Species:Mus musculus


Alignment Length:391 Identity:90/391 - (23%)
Similarity:154/391 - (39%) Gaps:95/391 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHEL--------MLKDRPRQEAYYNAILGNKDLFKDK----IVMDVGAGTGILSAF 57
            :.:|.|:.:.|:.        ||.|:.|...||..|.......||:    :|:|:|.|||:||..
Mouse    17 WLEEDEHYDYHQEIARSSYADMLHDKDRNIKYYQGIRAAVSRVKDRGQKALVLDIGTGTGLLSMM 81

  Fly    58 CAKAGARLVYAVEASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAE---KVDIIVSEWM 119
            ...|||...||:|......:.|:.::|.||.::.:|||.....|..:..:.:   :.:|:::|..
Mouse    82 AVTAGADFCYAIEVFKPMAEAAVKIVERNGFSDKIKVINKHSTEVTVGPDGDLPCRANILITELF 146

  Fly   120 GFYLLHEGMLDSVLLARDKFLKEGGLLFPSECTIFVAPCSVPSLFDDWHNVDGIKMDTFARKLRT 184
            ...|:.||.|.|...|....::|.....|...|::........:: .|:.:..:::.|   .|..
Mouse   147 DTELIGEGALPSYEHAHKHLVQEDCEAVPHRATVYAQLVESRRMW-SWNKLFPVRVRT---SLGE 207

  Fly   185 QKSSRP---------------EITQLNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKA 234
            |....|               ::.|::|.|         :..|.||  ..:.|:.|.:.:::..|
Mouse   208 QVIVPPSELERCPGAPSVCDIQLNQVSPAD---------FTVLSDV--LPMFSVDFSKQVSSSAA 261

  Fly   235 -----------GNHQGFCIWFDVQFPGE--------DFVLSTSP--LSPPTHWKQCVVVLPEESC 278
                       |..|....|:|::...|        .|...|.|  |....||.|||..||:|  
Mouse   262 CHSRQFVPLASGQAQVVLSWWDIEMDPEGKIKCTMAPFWAQTDPQELQWRDHWMQCVYFLPQE-- 324

  Fly   279 ENLEEKSP---IAFQ------ITMKRSAADMRKYNLEVDLLDPNTEEHPVPCSCHMTKCILTEAH 334
            |.:.:.||   :|..      .:::|::.|..         |...:..|| |.|        :||
Mouse   325 EPVVQGSPRCLVAHHDDYCVWYSLQRTSPDEN---------DSAYQVRPV-CDC--------QAH 371

  Fly   335 L 335
            |
Mouse   372 L 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 61/279 (22%)
Methyltransf_18 40..147 CDD:289607 33/113 (29%)
Prmt7NP_663379.1 AdoMet_MTases 37..>186 CDD:418430 42/148 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.