DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and prmt-1

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_507909.1 Gene:prmt-1 / 180326 WormBaseID:WBGene00013766 Length:348 Species:Caenorhabditis elegans


Alignment Length:332 Identity:120/332 - (36%)
Similarity:176/332 - (53%) Gaps:36/332 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            |||.|.:..|||.||||..|...|.|:|..|..|||||:|||||:||||||.|.|||||:.|:|:
 Worm    27 YFDSYAHFGIHEEMLKDEVRTTTYRNSIYHNSHLFKDKVVMDVGSGTGILSMFAAKAGAKKVFAM 91

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEE-FVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVL 133
            |.||:|. .:..:|.||.|.::|:|||::||: ..||...||||||:|||||:.|.:|.||::||
 Worm    92 EFSNMAL-TSRKIIADNNLDHIVEVIQAKVEDVHELPGGIEKVDIIISEWMGYCLFYESMLNTVL 155

  Fly   134 LARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD----WHNVDGIKMDTFARKLRTQKSSRPEI-- 192
            :|||::|...|:|||.:..::|.........:|    |.:|.|..|..    ::......|.:  
 Worm   156 VARDRWLAPNGMLFPDKARLYVCAIEDRQYKEDKIHWWDSVYGFNMSA----IKNVAIKEPLVDI 216

  Fly   193 ---TQLNPQDLLHEGVVFHWMNLLDVEASDLD-SIQFKEVITAQKAGNHQGFCIWFDVQFP--GE 251
               .|:|..:.|.:.|     :|..|:..||. ...||  :...::...|.|..:|.|:|.  .:
 Worm   217 VDNAQVNTNNCLLKDV-----DLYTVKIEDLTFKSDFK--LRCTRSDYIQAFVTFFTVEFSKCHK 274

  Fly   252 DFVLSTSPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADMRKYNLEV--------- 307
            ....||.|....|||||.|..|.:.......|:...:|::...::  :.|..::.:         
 Worm   275 KTGFSTGPDVQYTHWKQTVFYLKDALTVKKGEEITGSFEMAPNKN--NERDLDINISFDFKGEVC 337

  Fly   308 DLLDPNT 314
            ||.:.||
 Worm   338 DLNEQNT 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 100/249 (40%)
Methyltransf_18 40..147 CDD:289607 60/107 (56%)
prmt-1NP_507909.1 AdoMet_MTases 66..169 CDD:100107 57/103 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.