powered by:
Protein Alignment Art8 and C27F2.4
DIOPT Version :9
Sequence 1: | NP_609478.1 |
Gene: | Art8 / 34528 |
FlyBaseID: | FBgn0032329 |
Length: | 341 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498051.1 |
Gene: | C27F2.4 / 175671 |
WormBaseID: | WBGene00016166 |
Length: | 283 |
Species: | Caenorhabditis elegans |
Alignment Length: | 58 |
Identity: | 18/58 - (31%) |
Similarity: | 26/58 - (44%) |
Gaps: | 10/58 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 KDKIVMDVGAGTGILSAFCAKAGARLVYAVEASNVATKVAL--------DLI-EDNGL 88
|...::|:|.|||:.|.....||...| .|:.|....::|. |.| :|.||
Worm 53 KSGFLLDIGCGTGMSSEVILDAGHMFV-GVDVSRPMLEIARQDEDLESGDFIHQDMGL 109
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0500 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.