DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and prmt-7

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_492436.2 Gene:prmt-7 / 172727 WormBaseID:WBGene00012298 Length:647 Species:Caenorhabditis elegans


Alignment Length:285 Identity:66/285 - (23%)
Similarity:116/285 - (40%) Gaps:35/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MLKDRPRQEAYYNAILGNKDLFKDK---------IVMDVGAGTGILSAFCAKAGARLVYAVEASN 73
            |:.|..|.:.:   :.|.|....:|         .|:|:|.|||:||...|:.||..|.|:|...
 Worm    36 MILDFDRNDKF---LAGLKTTIAEKKHENTDGKVHVLDIGTGTGLLSLMAAREGADKVTALEVFK 97

  Fly    74 VATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLLARDK 138
            .....|..:..::..::.:.||..|..: |......:.||||:|.....|:.||.|.:...|.::
 Worm    98 PMGDCARHITSNSPWSDKITVISERSTD-VSQIGGSRADIIVAEVFDTELIGEGALRTFKEALER 161

  Fly   139 FLKEGGLLFPSECTIFVAPCS--VPSLFDDWHNVDGIK-MDTFARKLRTQKSSRPEITQLNPQDL 200
            ..|.|..:.||...:::.|..  :..:|:|...::|.| .:...|...|......:::::...:.
 Worm   162 LAKPGCRVVPSTGNVYIVPVESHLLKMFNDIPRLNGEKDEEPLGRCSGTAAVFDVQLSEMKTHEF 226

  Fly   201 --LHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQGFCIWFDVQFP--GEDFVLSTSPLS 261
              |.|.:|....:....|....|....:|.: |..:|......:|:|:...  |..|:    .:.
 Worm   227 RELSEPIVAFKFDFEHEEKIIFDESFVREAV-AHSSGTIDALLMWWDIDMDRNGTTFI----DMG 286

  Fly   262 PP----------THWKQCVVVLPEE 276
            |.          .||.|.|..|||:
 Worm   287 PKWKNKNNYAWRDHWMQAVYYLPEK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 54/239 (23%)
Methyltransf_18 40..147 CDD:289607 32/115 (28%)
prmt-7NP_492436.2 SmtA 19..258 CDD:223574 52/226 (23%)
AdoMet_MTases 34..>238 CDD:302624 49/205 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.