DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Prmt1

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_062804.1 Gene:Prmt1 / 15469 MGIID:107846 Length:371 Species:Mus musculus


Alignment Length:323 Identity:116/323 - (35%)
Similarity:170/323 - (52%) Gaps:40/323 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            |||.|.:..|||.||||..|...|.|::..|:.|||||:|:|||:|||||..|.||||||.|..:
Mouse    53 YFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGI 117

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            |.|:: :..|:.:::.|.|.:||.:|:.:|||..||  .||||||:|||||:.|.:|.||::||.
Mouse   118 ECSSI-SDYAVKIVKANKLDHVVTIIKGKVEEVELP--VEKVDIIISEWMGYCLFYESMLNTVLH 179

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD----------WHNVDGIKMDTFARKLRTQKSSR 189
            ||||:|...||:||...|::|      :..:|          |.||.|..|..    ::......
Mouse   180 ARDKWLAPDGLIFPDRATLYV------TAIEDRQYKDYKIHWWENVYGFDMSC----IKDVAIKE 234

  Fly   190 PEITQLNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNH--QGFCIWFDVQF---- 248
            |.:..::|:.|:....:...:::..|:..||   .|......|...|.  .....:|:::|    
Mouse   235 PLVDVVDPKQLVTNACLIKEVDIYTVKVEDL---TFTSPFCLQVKRNDYVHALVAYFNIEFTRCH 296

  Fly   249 --PGEDFVLSTSPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADMRKYNLEVDL 309
              .|    .||||.||.|||||.|..:  |....::....|...|.|:.:|.:.|..:..:||
Mouse   297 KRTG----FSTSPESPYTHWKQTVFYM--EDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 93/250 (37%)
Methyltransf_18 40..147 CDD:289607 57/106 (54%)
Prmt1NP_062804.1 AdoMet_MTases 92..192 CDD:100107 54/102 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.