DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and Prmt2

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001289894.1 Gene:Prmt2 / 15468 MGIID:1316652 Length:475 Species:Mus musculus


Alignment Length:316 Identity:113/316 - (35%)
Similarity:162/316 - (51%) Gaps:53/316 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCA-KAGARLVYA 68
            |||.|..|::|..||.|:||...|::.||.||:..|||:::|||.||||:|.||| .|..:.|||
Mouse   114 YFDSYGTLKLHLEMLADQPRTTKYHSVILQNKESLKDKVILDVGCGTGIISLFCAHHARPKAVYA 178

  Fly    69 VEASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVL 133
            ||||::|...: .|:..||..:.:.|.|.:||:.|||   ||||::||||||..||.|.|::|:|
Mouse   179 VEASDMAQHTS-QLVLQNGFADTITVFQQKVEDVVLP---EKVDVLVSEWMGTCLLFEFMIESIL 239

  Fly   134 LARDKFLKEGGLLFPSECTIFVAPCSVPS------LFDDWHNVDGIKMDTFARKLRTQKSSRPEI 192
            .|||.:||..|:::|:...:.:.|||...      ||  |.|.....:.........:..|||:.
Mouse   240 YARDTWLKGDGIIWPTTAALHLVPCSAEKDYHSKVLF--WDNAYEFNLSALKSLAIKEFFSRPKS 302

  Fly   193 TQ-LNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQGFCIWFDVQF-------P 249
            .. |.|:|.|.|......:::..|:..||::::.:.....||||...||..||.|.|       |
Mouse   303 NHILKPEDCLSEPCTILQLDMRTVQVPDLETMRGELRFDIQKAGTLHGFTAWFSVYFQSLEEGQP 367

  Fly   250 GEDFVLSTSPLSP------------------------------PTHWKQCVVVLPE 275
            .:  ||||.||.|                              .|||||.:.::.:
Mouse   368 QQ--VLSTGPLHPFLGRTGCQCRGPRWSCQMRPVGDRMLLSCSTTHWKQTLFMMDD 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 96/246 (39%)
Methyltransf_18 40..147 CDD:289607 55/107 (51%)
Prmt2NP_001289894.1 SH3_PRMT2 46..98 CDD:212740
AdoMet_MTases 122..>181 CDD:302624 30/58 (52%)
AdoMet_MTases 153..253 CDD:100107 52/103 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848847
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D387140at33208
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.