DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and BUD23

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_006715910.1 Gene:BUD23 / 114049 HGNCID:16405 Length:304 Species:Homo sapiens


Alignment Length:286 Identity:51/286 - (17%)
Similarity:80/286 - (27%) Gaps:128/286 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAVEASNVATKVALDLIEDNGLTNVVKVIQSRV 99
            ||..:    ::|:|.|||:..::                         :.|.|            
Human    75 NKPCY----LLDIGCGTGLSGSY-------------------------LSDEG------------ 98

  Fly   100 EEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVL---LARDKFLKEGGLLFPSECTIFVAPCSVP 161
                            ..|:|.. :...|||..:   :..|..|.:.|...|.:          |
Human    99 ----------------HYWVGLD-ISPAMLDEAVDREIEGDLLLGDMGQGIPFK----------P 136

  Fly   162 SLFDDWHNVDGIKMDTFARKLRTQKSSRP--------------------EITQLNPQDLLHEGVV 206
            ..||...::..::....|.|    ||..|                    .:.||.|:        
Human   137 GTFDGCISISAVQWLCNANK----KSENPAKRLYCFFASLFSVLVRGSRAVLQLYPE-------- 189

  Fly   207 FHWMNLLDVEASDLDSIQFKEVITAQ--KAGNHQGFCIWFDVQFPGEDFVLSTSPLSPPTHWKQC 269
                          :|.|. |:||.|  |||...|..:.:......:.|.|..  .|.|:     
Human   190 --------------NSEQL-ELITTQATKAGFSGGMVVDYPNSAKAKKFYLCL--FSGPS----- 232

  Fly   270 VVVLPEESCENLEEKSPIAFQITMKR 295
             ..:||...||.:|..|.....|.:|
Human   233 -TFIPEGLSENQDEVEPRESVFTNER 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 39/233 (17%)
Methyltransf_18 40..147 CDD:289607 15/109 (14%)
BUD23XP_006715910.1 AdoMet_MTases 38..>117 CDD:302624 14/99 (14%)
Methyltransf_11 81..184 CDD:285453 24/170 (14%)
WBS_methylT 227..302 CDD:289366 10/39 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.