DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and CARM1

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_954592.1 Gene:CARM1 / 10498 HGNCID:23393 Length:608 Species:Homo sapiens


Alignment Length:361 Identity:126/361 - (34%)
Similarity:178/361 - (49%) Gaps:58/361 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            ||..|..|...:.|::|..|...|..|||.|...||||||:|||.|:||||.|.|:||||.:|||
Human   149 YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAV 213

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            |||.:|....: |::.|.||:.:.||..:|||..||   |:||||:||.||:.|.:|.||:|.|.
Human   214 EASTMAQHAEV-LVKSNNLTDRIVVIPGKVEEVSLP---EQVDIIISEPMGYMLFNERMLESYLH 274

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD-------W-----HNVD-----GIKMDTFARKL 182
            |: |:||..|.:||:...:.:||.:...|:.:       |     |.||     |..:|.:.|  
Human   275 AK-KYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFR-- 336

  Fly   183 RTQKSSRPEITQLNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQGFCIWFDVQ 247
                  :|.:...:.:.|:.:.|.: .:|.|:.:..||..|:.........:|...|...||||.
Human   337 ------QPVVDTFDIRILMAKSVKY-TVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVA 394

  Fly   248 FPGEDFV--LSTSPLSPPTHWKQ--CVVVLP--EESCENLEEKSPIAFQITMKRSAADM------ 300
            |.|....  |||:|..|.|||.|  |:...|  .::.:.|   |.....|..||.:.|:      
Human   395 FIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTL---SGTCLLIANKRQSYDISIVAQV 456

  Fly   301 -----RKYNLEVDLLDP-----NTEEHPVPCSCHMT 326
                 :..|| :||.:|     .|...|.|.| |.|
Human   457 DQTGSKSSNL-LDLKNPFFRYTGTTPSPPPGS-HYT 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 92/255 (36%)
Methyltransf_18 40..147 CDD:289607 57/106 (54%)
CARM1NP_954592.1 CARM1 34..138 CDD:288395
PRMT5 <172..435 CDD:282971 103/279 (37%)
Methyltransf_18 184..283 CDD:289607 56/103 (54%)
Transactivation domain. /evidence=ECO:0000250 499..608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.