DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art8 and carm1

DIOPT Version :9

Sequence 1:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_002942887.1 Gene:carm1 / 100170180 XenbaseID:XB-GENE-484572 Length:602 Species:Xenopus tropicalis


Alignment Length:349 Identity:121/349 - (34%)
Similarity:171/349 - (48%) Gaps:66/349 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69
            ||..|..|...:.|::|..|...|..|||.|...||||:|:|||.|:||||.|..:||||.||||
 Frog   120 YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKVVLDVGCGSGILSFFAVQAGARKVYAV 184

  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134
            |||.:|....| |::.|.||:.:.||..:|||..||   |:||||:||.||:.|.:|.||:|.|.
 Frog   185 EASTMAQHAEL-LVKSNNLTDRIVVIPGKVEETALP---EQVDIIISEPMGYMLFNERMLESYLH 245

  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD-------W-----HNVD-----GIKMDTFARKL 182
            |: ||||..|.:||:...:.:||.:...|:.:       |     |.||     |..:|.:.:  
 Frog   246 AK-KFLKPNGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFK-- 307

  Fly   183 RTQKSSRPEITQLNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQGFCIWFDVQ 247
                  :|.:...:.:.|:.:.|.: .:|.||.:.:||..|:.........:|...|...||||.
 Frog   308 ------QPVVDTFDIRILMAKSVKY-TVNFLDAKEADLHRIEIPFSFHMLHSGLVHGLAFWFDVA 365

  Fly   248 FPGEDFV--LSTSPLSPPTHWKQCVVVLPEESCENLEEKSPI-----------AFQITMKRSAAD 299
            |.|....  |||:|..|.|||.|...:|          :||:           |..|..||.:.|
 Frog   366 FIGSIMTVWLSTAPTEPLTHWYQVRCLL----------QSPLFTKAGDTLTGTALLIANKRQSYD 420

  Fly   300 M-----------RKYNLEVDLLDP 312
            :           :..|| :||.:|
 Frog   421 ISIVAQVDQTGSKSSNL-LDLKNP 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art8NP_609478.1 SmtA 1..244 CDD:223574 93/255 (36%)
Methyltransf_18 40..147 CDD:289607 58/106 (55%)
carm1XP_002942887.1 CARM1 9..109 CDD:371585
Methyltransf_25 159..254 CDD:379312 54/99 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.