DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL9 and MRPL6

DIOPT Version :9

Sequence 1:NP_001285826.1 Gene:RpL9 / 34526 FlyBaseID:FBgn0015756 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_012017.1 Gene:MRPL6 / 856552 SGDID:S000001190 Length:214 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:41/203 - (20%)
Similarity:81/203 - (39%) Gaps:44/203 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TINSNQCVKIPKDIKASVK-ARVVTITGTRGTLK----------RSFKHLALDMYMPDKRTLKVE 56
            :||:....:|.:..:.|:. ::.:|:.|.:|.|.          :..||..:::.:.:.......
Yeast    33 SINALSMPRIIRKGRTSMNISQNITVKGPKGELSVEVPDFLHLDKDEKHGKINVTVQNSEDKHQR 97

  Fly    57 KWFGTKKELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKYI 121
            ..:||.:.|         |.|.|.|||.|....:|.|...:  ......:...:.::  :|....
Yeast    98 SMWGTVRSL---------INNHIIGVTEGHLAVLRFVGTGY--RAQLENDGKFVNVK--VGASIK 149

  Fly   122 RRVEMAPGVTVVNSTAQKDELIVEGNDIESVSGSAALIQQSTTVKNKDIRKFL-------DGLYV 179
            :.:::..|:.|  .|.....||:||.:.:.|...||           .:|||.       .|:||
Yeast   150 QGLDVPEGIVV--KTPAPTSLIIEGCNKQQVLLFAA-----------KLRKFHPPEPYKGKGIYV 201

  Fly   180 SEKTTVVK 187
            :::|..:|
Yeast   202 NDETIKLK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL9NP_001285826.1 Ribosomal_L6 1..189 CDD:421973 41/203 (20%)
MRPL6NP_012017.1 RplF 16..212 CDD:223175 41/203 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.