DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL9 and emb2394

DIOPT Version :10

Sequence 1:NP_477161.1 Gene:RpL9 / 34526 FlyBaseID:FBgn0015756 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_172011.1 Gene:emb2394 / 839273 AraportID:AT1G05190 Length:223 Species:Arabidopsis thaliana


Alignment Length:157 Identity:28/157 - (17%)
Similarity:68/157 - (43%) Gaps:15/157 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYMPDKRTLKVEKWFGTKKE---LAAVR 69
            |.:.:|.::..:::.:.:.:.|..|.|..::.. .:::...:...|:|:|...|::.   ....|
plant    49 QPIAVPSNVTIALEGQDLKVKGPLGELALTYPR-EVELTKEESGFLRVKKTVETRRANQMHGLFR 112

  Fly    70 TVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKYIRRVEMAPGVTVVN 134
            |:   .:||:.||:.||:.|:..|...:  .........|:.    ||..:..::::...:.|  
plant   113 TL---TDNMVVGVSKGFEKKLILVGVGY--RATVDGKELVLN----LGFSHPVKMQIPDSLKV-- 166

  Fly   135 STAQKDELIVEGNDIESVSGSAALIQQ 161
            ...:...:.|.|.|...:...||.:::
plant   167 KVEENTRITVSGYDKSEIGQFAATVRK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL9NP_477161.1 PTZ00027 1..189 CDD:240234 28/157 (18%)
emb2394NP_172011.1 RplF 44..221 CDD:439867 28/157 (18%)

Return to query results.
Submit another query.