DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL9 and RPL9

DIOPT Version :9

Sequence 1:NP_001285826.1 Gene:RpL9 / 34526 FlyBaseID:FBgn0015756 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_000652.2 Gene:RPL9 / 6133 HGNCID:10369 Length:192 Species:Homo sapiens


Alignment Length:187 Identity:122/187 - (65%)
Similarity:151/187 - (80%) Gaps:2/187 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYM--PDKRTLKVEKWFGTKK 63
            |:||.|||.|.||:::..::|.|.|.:.|.||||:|.|.|:.:::.:  ..|:.|:|:||:|.:|
Human     1 MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRK 65

  Fly    64 ELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKYIRRVEMAP 128
            |||.|||:|||::|||||||.||:||||:||||||||.|..||.:::||||||||||||||.|.|
Human    66 ELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRP 130

  Fly   129 GVTVVNSTAQKDELIVEGNDIESVSGSAALIQQSTTVKNKDIRKFLDGLYVSEKTTV 185
            ||....|.|||||||:||||||.||.|||||||:||||||||||||||:|||||.||
Human   131 GVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL9NP_001285826.1 Ribosomal_L6 1..189 CDD:421973 122/187 (65%)
RPL9NP_000652.2 Ribosomal_L6 1..191 CDD:421973 122/187 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160436
Domainoid 1 1.000 122 1.000 Domainoid score I5674
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90855
Inparanoid 1 1.050 249 1.000 Inparanoid score I3249
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62200
OrthoDB 1 1.010 - - D1408258at2759
OrthoFinder 1 1.000 - - FOG0001024
OrthoInspector 1 1.000 - - oto91161
orthoMCL 1 0.900 - - OOG6_100791
Panther 1 1.100 - - LDO PTHR11655
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1146
SonicParanoid 1 1.000 - - X698
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.900

Return to query results.
Submit another query.