DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL9 and rpl9

DIOPT Version :9

Sequence 1:NP_001285826.1 Gene:RpL9 / 34526 FlyBaseID:FBgn0015756 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001003861.1 Gene:rpl9 / 336702 ZFINID:ZDB-GENE-030131-8646 Length:193 Species:Danio rerio


Alignment Length:189 Identity:120/189 - (63%)
Similarity:150/189 - (79%) Gaps:2/189 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYMPDK--RTLKVEKWFGTKK 63
            |:||.|||.|.||.::..|:|.|.||:.|.||.|:|.|.|:.|::.:..|  :.|:|:||:|.:|
Zfish     1 MKTILSNQTVDIPDNVTVSLKGRTVTVKGPRGVLRREFNHINLELSLLGKKQKKLRVDKWWGNRK 65

  Fly    64 ELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKYIRRVEMAP 128
            |||.|||:|||::|||||||.||:||||:||||||||.|..|:.:::||||||||||||||.|..
Zfish    66 ELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQESGSLVEIRNFLGEKYIRRVRMRQ 130

  Fly   129 GVTVVNSTAQKDELIVEGNDIESVSGSAALIQQSTTVKNKDIRKFLDGLYVSEKTTVVK 187
            ||....|.||||||::||||||.||.|||||||:|||:.|||||||||:|||||.|||:
Zfish   131 GVACAVSAAQKDELVLEGNDIELVSNSAALIQQATTVRKKDIRKFLDGIYVSEKGTVVE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL9NP_001285826.1 Ribosomal_L6 1..189 CDD:421973 120/189 (63%)
rpl9NP_001003861.1 PTZ00027 1..189 CDD:240234 119/187 (64%)
Ribosomal_L6 12..87 CDD:278762 38/74 (51%)
Ribosomal_L6 99..178 CDD:278762 55/78 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596807
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0097
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H90855
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408258at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.