DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL9 and rpl902

DIOPT Version :9

Sequence 1:NP_001285826.1 Gene:RpL9 / 34526 FlyBaseID:FBgn0015756 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_587694.1 Gene:rpl902 / 2539464 PomBaseID:SPCC613.06 Length:189 Species:Schizosaccharomyces pombe


Alignment Length:188 Identity:96/188 - (51%)
Similarity:132/188 - (70%) Gaps:1/188 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYMPDKRTLKVEKWFGTKKELA 66
            |.|..::.:.||:.:...:|||:||:.|.||.||::.:.:.::: .....|:|...|.|::|..|
pombe     3 RDIYKDETLTIPEGVSVDIKARLVTVKGPRGVLKQNLRRVDIEL-KKQGNTIKFIVWHGSRKHNA 66

  Fly    67 AVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKYIRRVEMAPGVT 131
            .:||..|.|.|||.|||.||:||||.||||||||...:||.||:||||||||:..|.::..||||
pombe    67 CIRTAYSIINNMIIGVTQGFRYKMRLVYAHFPININLTENGTVVEIRNFLGERITRVIKCLPGVT 131

  Fly   132 VVNSTAQKDELIVEGNDIESVSGSAALIQQSTTVKNKDIRKFLDGLYVSEKTTVVKLE 189
            |..|:|.|||:|:|||.:|:||.|||.|:|...|:||||||||||:||||:..:.:||
pombe   132 VSISSAVKDEIIIEGNSLENVSQSAANIKQICNVRNKDIRKFLDGIYVSERGNIEELE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL9NP_001285826.1 Ribosomal_L6 1..189 CDD:421973 94/186 (51%)
rpl902NP_587694.1 PTZ00027 3..189 CDD:240234 94/186 (51%)
Ribosomal_L6 13..85 CDD:278762 28/72 (39%)
Ribosomal_L6 97..176 CDD:278762 48/78 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 99 1.000 Domainoid score I1837
eggNOG 1 0.900 - - E1_COG0097
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90855
Inparanoid 1 1.050 195 1.000 Inparanoid score I1023
OMA 1 1.010 - - QHG62200
OrthoFinder 1 1.000 - - FOG0001024
OrthoInspector 1 1.000 - - otm47374
orthoMCL 1 0.900 - - OOG6_100791
Panther 1 1.100 - - O PTHR11655
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1146
SonicParanoid 1 1.000 - - X698
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.