DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL9 and Rpl9

DIOPT Version :9

Sequence 1:NP_001285826.1 Gene:RpL9 / 34526 FlyBaseID:FBgn0015756 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_035422.1 Gene:Rpl9 / 20005 MGIID:1298373 Length:192 Species:Mus musculus


Alignment Length:187 Identity:121/187 - (64%)
Similarity:151/187 - (80%) Gaps:2/187 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYM--PDKRTLKVEKWFGTKK 63
            |:||.|||.|.||::::.::|.|.|.:.|.||||:|.|.|:.:::.:  ..|:.|:|:||:|.:|
Mouse     1 MKTILSNQTVDIPENVEITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRK 65

  Fly    64 ELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKYIRRVEMAP 128
            |||.|||:|||::|||||||.||:||||:||||||||.|..||.:::||||||||||||||.|..
Mouse    66 ELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRT 130

  Fly   129 GVTVVNSTAQKDELIVEGNDIESVSGSAALIQQSTTVKNKDIRKFLDGLYVSEKTTV 185
            ||....|.|||||||:||||||.||.|||||||:||||||||||||||:|||||.||
Mouse   131 GVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL9NP_001285826.1 Ribosomal_L6 1..189 CDD:421973 121/187 (65%)
Rpl9NP_035422.1 PTZ00027 1..191 CDD:240234 121/187 (65%)
Ribosomal_L6 12..87 CDD:278762 36/74 (49%)
Ribosomal_L6 99..178 CDD:278762 59/78 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850784
Domainoid 1 1.000 119 1.000 Domainoid score I5785
eggNOG 1 0.900 - - E1_COG0097
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90855
Inparanoid 1 1.050 248 1.000 Inparanoid score I3229
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62200
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001024
OrthoInspector 1 1.000 - - otm44018
orthoMCL 1 0.900 - - OOG6_100791
Panther 1 1.100 - - LDO PTHR11655
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1146
SonicParanoid 1 1.000 - - X698
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.