DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL9 and LOC103692829

DIOPT Version :9

Sequence 1:NP_001285826.1 Gene:RpL9 / 34526 FlyBaseID:FBgn0015756 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_038936008.1 Gene:LOC103692829 / 103692829 RGDID:9187595 Length:188 Species:Rattus norvegicus


Alignment Length:187 Identity:121/187 - (64%)
Similarity:150/187 - (80%) Gaps:2/187 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYM--PDKRTLKVEKWFGTKK 63
            |:||.|||.|.||:::..::|.|.|.:.|.||||:|.|.|:.:::.:  ..|:.|:|:||:|.:|
  Rat     1 MKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRK 65

  Fly    64 ELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKYIRRVEMAP 128
            |||.|||:|||::|||||||.||:||||:||||||||.|..||.:::||||||||||||||.|..
  Rat    66 ELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRT 130

  Fly   129 GVTVVNSTAQKDELIVEGNDIESVSGSAALIQQSTTVKNKDIRKFLDGLYVSEKTTV 185
            ||....|.|||||||:||||||.||.|||||||:||||||||||||||:|||||.||
  Rat   131 GVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL9NP_001285826.1 Ribosomal_L6 1..189 CDD:421973 121/187 (65%)
LOC103692829XP_038936008.1 Ribosomal_L6 1..187 CDD:421973 119/185 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354498
Domainoid 1 1.000 119 1.000 Domainoid score I5646
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 246 1.000 Inparanoid score I3187
OMA 1 1.010 - - QHG62200
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001024
OrthoInspector 1 1.000 - - otm46110
orthoMCL 1 0.900 - - OOG6_100791
Panther 1 1.100 - - LDO PTHR11655
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X698
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.