DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL9 and LOC103692519

DIOPT Version :9

Sequence 1:NP_001285826.1 Gene:RpL9 / 34526 FlyBaseID:FBgn0015756 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_038967503.1 Gene:LOC103692519 / 103692519 RGDID:9461644 Length:192 Species:Rattus norvegicus


Alignment Length:187 Identity:117/187 - (62%)
Similarity:149/187 - (79%) Gaps:2/187 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYM--PDKRTLKVEKWFGTKK 63
            |:||.|||.|.||:::..::|...|.:.|.:|||:|.|.|:.:::.:  ..|:.|:|:||:|.:|
  Rat     1 MKTILSNQTVNIPENVDITLKGCTVIVKGPKGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRK 65

  Fly    64 ELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKYIRRVEMAP 128
            |||.|||:|||::|||||||.||.||||:||||||||.|..||.:::||||||||||||||:|..
  Rat    66 ELATVRTICSHVQNMIKGVTLGFCYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVQMRT 130

  Fly   129 GVTVVNSTAQKDELIVEGNDIESVSGSAALIQQSTTVKNKDIRKFLDGLYVSEKTTV 185
            ||....|.|||||||:||||||.||.|||:|||:||||||||||||||:|||||.|:
  Rat   131 GVARSVSQAQKDELILEGNDIELVSNSAAVIQQATTVKNKDIRKFLDGIYVSEKGTM 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL9NP_001285826.1 Ribosomal_L6 1..189 CDD:421973 117/187 (63%)
LOC103692519XP_038967503.1 Ribosomal_L6 1..189 CDD:421973 117/187 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11655
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.