DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL9 and rpl9

DIOPT Version :9

Sequence 1:NP_001285826.1 Gene:RpL9 / 34526 FlyBaseID:FBgn0015756 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_031751239.1 Gene:rpl9 / 100379906 XenbaseID:XB-GENE-964745 Length:202 Species:Xenopus tropicalis


Alignment Length:191 Identity:122/191 - (63%)
Similarity:154/191 - (80%) Gaps:2/191 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYM--PDKRTLKVEKWFGTKK 63
            |:||.|||.|.||:::..|:|.|.||:.|.||.|:::|.|:.:::.:  ..||.|:|:||:|.:|
 Frog    11 MKTILSNQIVDIPENVDISLKGRTVTVKGPRGVLRKNFNHINVELCLLGKKKRRLRVDKWWGNRK 75

  Fly    64 ELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKYIRRVEMAP 128
            |||.|||:|||::||:||||.||:||||:||||||||.|..||.:::||||||||||||||.|..
 Frog    76 ELATVRTICSHVQNMVKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRS 140

  Fly   129 GVTVVNSTAQKDELIVEGNDIESVSGSAALIQQSTTVKNKDIRKFLDGLYVSEKTTVVKLE 189
            ||....|.|||||||:||||||.||.|||||||:||||||||||||||:|||||.||.::|
 Frog   141 GVACALSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQVE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL9NP_001285826.1 Ribosomal_L6 1..189 CDD:421973 121/189 (64%)
rpl9XP_031751239.1 Ribosomal_L6 11..201 CDD:421973 121/189 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 120 1.000 Domainoid score I5705
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H90855
Inparanoid 1 1.050 250 1.000 Inparanoid score I3160
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408258at2759
OrthoFinder 1 1.000 - - FOG0001024
OrthoInspector 1 1.000 - - oto104942
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1146
SonicParanoid 1 1.000 - - X698
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.