Sequence 1: | NP_940908.3 | Gene: | LRIT3 / 345193 | HGNCID: | 24783 | Length: | 679 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001137799.1 | Gene: | DIP-epsilon / 7354433 | FlyBaseID: | FBgn0259714 | Length: | 467 | Species: | Drosophila melanogaster |
Alignment Length: | 254 | Identity: | 55/254 - (21%) |
---|---|---|---|
Similarity: | 87/254 - (34%) | Gaps: | 91/254 - (35%) |
- Green bases have known domain annotations that are detailed below.
Human 111 RLDGNSLAAFPWASLLDMPLLRTLDLHNNKITSVPNEALRYLKNLAYLDLSSNRLTTLPPDFLES 175
Human 176 WTHLVSTPSGVLDLSPSRIILGLQDNPWFCDCHISKMIELSKVVDPAIVLLDPLMTCSEPERLTG 240
Human 241 ILFQRAELEHCLKPSVMTSATKIMSALGSNVLLRCDATGFPTPQITWTR------SDSSPVNYTV 299
Human 300 IQESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGMSEAVVTVTVLGITTTPIPPDTS 358 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
LRIT3 | NP_940908.3 | LRR 1 | 56..79 | ||
leucine-rich repeat | 59..82 | CDD:275378 | |||
LRR_8 | 61..117 | CDD:290566 | 4/5 (80%) | ||
LRR 2 | 80..103 | ||||
leucine-rich repeat | 83..106 | CDD:275378 | |||
LRR 3 | 104..128 | 4/16 (25%) | |||
LRR_8 | 105..165 | CDD:290566 | 15/53 (28%) | ||
LRR_4 | 105..146 | CDD:289563 | 8/34 (24%) | ||
leucine-rich repeat | 107..130 | CDD:275378 | 4/18 (22%) | ||
LRR 4 | 129..151 | 5/21 (24%) | |||
LRR_4 | 131..170 | CDD:289563 | 11/38 (29%) | ||
leucine-rich repeat | 131..154 | CDD:275378 | 6/22 (27%) | ||
LRR 5 | 152..175 | 8/22 (36%) | |||
leucine-rich repeat | 155..168 | CDD:275378 | 5/12 (42%) | ||
Ig | 267..345 | CDD:299845 | 24/83 (29%) | ||
IG_like | 267..345 | CDD:214653 | 24/83 (29%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 351..375 | 4/8 (50%) | |||
FN3 | 486..550 | CDD:214495 | |||
DIP-epsilon | NP_001137799.1 | IG_like | 59..155 | CDD:214653 | |
Ig | 69..139 | CDD:143165 | |||
IG_like | 165..249 | CDD:214653 | 20/105 (19%) | ||
IGc2 | 172..237 | CDD:197706 | 15/56 (27%) | ||
IG_like | 267..348 | CDD:214653 | 24/81 (30%) | ||
Ig | 270..339 | CDD:299845 | 21/69 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |