DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCAR and LOC100125044

DIOPT Version :9

Sequence 1:NP_001260368.1 Gene:SCAR / 34519 FlyBaseID:FBgn0041781 Length:674 Species:Drosophila melanogaster
Sequence 2:NP_001096434.1 Gene:LOC100125044 / 100125044 -ID:- Length:134 Species:Xenopus tropicalis


Alignment Length:91 Identity:55/91 - (60%)
Similarity:65/91 - (71%) Gaps:2/91 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARDVGNIG 65
            |||.||:|||.|:.|... .|.:.| |||.|||:||..||:||.|||:||||:||||..:..:..
 Frog     1 MPLVKRNIEPRHLCRGTV-PDGVTS-ELECVTNSTLAAIIKQLGSLSRHAEDIFGELFNEANSFY 63

  Fly    66 DRANSLQARIDRLAIKVTQLDSTVEE 91
            .|.||||.|:|.|.||||||||||||
 Frog    64 MRMNSLQERVDLLVIKVTQLDSTVEE 89



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1183697at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.