DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14070 and ERV29

DIOPT Version :9

Sequence 1:NP_001285818.1 Gene:CG14070 / 34508 FlyBaseID:FBgn0032313 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_011800.3 Gene:ERV29 / 853201 SGDID:S000003516 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:239 Identity:58/239 - (24%)
Similarity:108/239 - (45%) Gaps:55/239 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YFMEVLYSVVNTPLVGRERAIVMDVNECFGHFYTCFDVLLTIGAIFLILGTRKEASGVTLLLIGR 73
            ||..|::.||.|                         |.:.|||..|:|  ||:.:..|.:|...
Yeast   108 YFFVVVFLVVVT-------------------------VSMLIGASLLVL--RKQTNYATGVLCAC 145

  Fly    74 VIHR-LFFSIWTMFFYFLFNDSLDVGSLLLLMAAKI-----------NLRDQMDWFQSKYHILLL 126
            ||.: |.:.::|...:.|.|.|: :|.||:..:..|           .|..:.|  ::|.: ||.
Yeast   146 VISQALVYGLFTGSSFVLRNFSV-IGGLLIAFSDSIVQNKTTFGMLPELNSKND--KAKGY-LLF 206

  Fly   127 GGRLCLSSLYIIWIDEGLETLFSIV--SFGLLVFIWLGFHCKLFAYLTVIALLYHDVFSNHWSML 189
            .||:.:..::|.:...  ::.|::|  ..|.:.|. :|:..|..:.:..:.|.::::..|::   
Yeast   207 AGRILIVLMFIAFTFS--KSWFTVVLTIIGTICFA-IGYKTKFASIMLGLILTFYNITLNNY--- 265

  Fly   190 WGWNDT---LLSIQYFSLLFCKIGGFLMLSELGGGRWSVDGYRK 230
            |.:|:|   .|..:::..|.. |||.|:::..|.|..|||..:|
Yeast   266 WFYNNTKRDFLKYEFYQNLSI-IGGLLLVTNTGAGELSVDEKKK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14070NP_001285818.1 DoxX <46..231 CDD:304411 52/202 (26%)
ERV29NP_011800.3 DoxX 48..310 CDD:419711 58/239 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2259
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.