DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14070 and surf4l

DIOPT Version :9

Sequence 1:NP_001285818.1 Gene:CG14070 / 34508 FlyBaseID:FBgn0032313 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001002470.1 Gene:surf4l / 436743 ZFINID:ZDB-GENE-040718-172 Length:269 Species:Danio rerio


Alignment Length:237 Identity:58/237 - (24%)
Similarity:101/237 - (42%) Gaps:39/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YFMEVLYSVVNTPLVGRERAIVMDVNECFGHFYTCFDVLLTIGAIFLILGTRKEASGVTLLLIGR 73
            :|:..|:.::|  |:|:....::.::..|.. |.||       .:|.|:..:..|..:       
Zfish    63 FFLATLFVLIN--LLGQLGGCILILSRNFVQ-YACF-------GLFAIIALQTVAYSI------- 110

  Fly    74 VIHRLFFSIWTMFFYFLFNDSLDVGSLLLLMAAKINLRDQMDWF-----QSKYHILLLGGRLCLS 133
                    :|...| .:.|.:|..|.||||..::...|......     .|....:.||||:.|.
Zfish   111 --------LWDPKF-LMRNLALGGGLLLLLAESRSEGRSMFAGVPTMRESSPKQYMQLGGRVLLV 166

  Fly   134 SLY--IIWIDEG-LETLFSIVSFGLLVFIWLGFHCKLFAYLTVIALLYHDVFSNHWSMLWGWNDT 195
            .::  ::..|.. |..|.::|...|:|.:.:||..||.|...||.||..:|:.|.:..:..:...
Zfish   167 LMFMTLLHFDTSFLSILQNLVGTALIVLVAIGFKTKLAALTLVIWLLAINVYFNAFWTIPAYKPM 231

  Fly   196 LLSIQY-FSLLFCKIGGFLMLSELGGGRWSVDGYRKRSGEKW 236
            ...::| |......|||.|::..||.|..|:|..:|    :|
Zfish   232 HDFLKYDFFQTTSVIGGLLLIVALGPGGVSMDEKKK----EW 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14070NP_001285818.1 DoxX <46..231 CDD:304411 47/193 (24%)
surf4lNP_001002470.1 SURF4 4..269 CDD:111019 57/235 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2259
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.