DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14070 and SPCC970.06

DIOPT Version :9

Sequence 1:NP_001285818.1 Gene:CG14070 / 34508 FlyBaseID:FBgn0032313 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_587849.1 Gene:SPCC970.06 / 2539516 PomBaseID:SPCC970.06 Length:302 Species:Schizosaccharomyces pombe


Alignment Length:257 Identity:57/257 - (22%)
Similarity:111/257 - (43%) Gaps:43/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QYFVMSYYFMEVLYSVVNTPLVGRERAIVMDVNEC-FGH----FYTCFDVLLTIGAIFLILGTRK 61
            ::.:::.||.:.:..|...|   .:.:.:.|.... ||.    .:.|. ||:.:|:. |::..::
pombe    59 RFLIVATYFEDAIRIVTQWP---EQVSYMRDYRRFRFGTAPLLLFVCV-VLMLVGST-LVVFKKR 118

  Fly    62 EASGVTLLLIGRVIHRLFFSIWTMFFYFLFNDSLDVGSLLLLMA-----AKINL---------RD 112
            :|..:..||...::....:.:.|....|..|.|: :|.|.|:.:     .:||.         .:
pombe   119 QAYAIGSLLFVTLLQAFAYGLITSGEMFFRNMSV-IGGLCLVASDTFIHRRINRFAGLPAVSEHN 182

  Fly   113 QMDWFQSKYHILLLGGRLCLSSLYI-IWIDEG-----LETLFSIVSFGLLVFIWLGFHCKLFAYL 171
            :..:||       |.||:.|..::: :...||     ...|..|:|......:.:||..|.||.:
pombe   183 KRTYFQ-------LAGRVLLIFMFLGLLAKEGSGISWTRILVHILSVTACAMVVIGFKAKFFAAV 240

  Fly   172 TVIAL-LYHDVFSNHWSM--LWGWNDTLLSIQYFSLLFCKIGGFLMLSELGGGRWSVDGYRK 230
            .|:.| :.:.:.::.||:  ...:.| .....:|..|.. :||.|.|...|.|::|||..:|
pombe   241 LVLILSVANFIINSFWSVPRESPYRD-FYRYDFFQTLSI-VGGLLYLVNTGPGKFSVDEKKK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14070NP_001285818.1 DoxX <46..231 CDD:304411 49/208 (24%)
SPCC970.06NP_587849.1 SURF4 33..302 CDD:111019 57/257 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2259
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.