DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14070 and T02E1.7

DIOPT Version :9

Sequence 1:NP_001285818.1 Gene:CG14070 / 34508 FlyBaseID:FBgn0032313 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_492235.1 Gene:T02E1.7 / 187988 WormBaseID:WBGene00011379 Length:269 Species:Caenorhabditis elegans


Alignment Length:224 Identity:53/224 - (23%)
Similarity:102/224 - (45%) Gaps:35/224 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VNECFGHFYTCFDVL-LTIGAIFLILGTRKEASGVTL--LLIGRVIHRLFFSIWTMFFYFLFNDS 94
            :|..|..|.|...:: |..|::|:::..:...|...|  .:..:||   .:.::|.  |.|...:
 Worm    61 LNYHFSLFLTIVMIINLLFGSLFVMMRYKVTESSAVLGFTIFAQVI---LYQLYTT--YHLLTRN 120

  Fly    95 LDVGSLLLLMAAKINLRDQMDWFQSKY-------------HILLLGGRLCLSSLYIIWIDEGL-- 144
            :.:.:.::|:.|:..||...   .:.|             .:||...|:||:.:.|..:...:  
 Worm   121 ISIVAAIMLLVAENMLRKPK---PANYTQLPRDEHEIEVTSVLLAACRVCLNLMLISMVHFDMSY 182

  Fly   145 -ETLFSIVSFGLLVFIWLGFHCKLFAYLTVIALLYHDVFSNHWSMLWGWNDTLLSIQY-FSLLFC 207
             ..|..|:|:|:::|:||||..::.:::....|..:::..|.:   |..:..|..|:| |.....
 Worm   183 TRILLCIISYGMMIFVWLGFKTRMMSFMLATWLFAYNIVLNDF---WNKDAELHIIRYDFFQTLS 244

  Fly   208 KIGGFLMLSELGGGRWSVDGYRKRSGEKW 236
            .|||.|:|...|.|.:|.|..:|    ||
 Worm   245 AIGGLLLLIHTGPGEFSFDELKK----KW 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14070NP_001285818.1 DoxX <46..231 CDD:304411 46/204 (23%)
T02E1.7NP_492235.1 SURF4 4..269 CDD:111019 51/222 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2259
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.