DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12517 and CG14069

DIOPT Version :10

Sequence 1:NP_609465.1 Gene:CG12517 / 34506 FlyBaseID:FBgn0032311 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_609469.1 Gene:CG14069 / 34510 FlyBaseID:FBgn0032315 Length:101 Species:Drosophila melanogaster


Alignment Length:108 Identity:29/108 - (26%)
Similarity:48/108 - (44%) Gaps:23/108 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IYVPGSEDDLDWTGANWQLVVRFLMQRQ--QLRFCIALARFDEQLVP--GTACQALLANGPLMAN 95
            :::|.....||...|||...:...:|.|  :|.:|.:|.: .:..:|  .|.|..:|:|      
  Fly    13 MFIPLILMQLDPQIANWSAQIALELQEQPDKLAYCRSLQQ-QKLRIPLQNTGCATILSN------ 70

  Fly    96 CDIGNIEDLTMTLRYAFGEILLDTSRKCRPGLELFGVRCRRRA 138
                   .|.:|     ||:||:..::|..|..|...|||:.|
  Fly    71 -------QLGVT-----GEMLLEIQKRCWAGWGLLAGRCRKLA 101

Return to query results.
Submit another query.