DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stam and AT1G06210

DIOPT Version :9

Sequence 1:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_563762.1 Gene:AT1G06210 / 837130 AraportID:AT1G06210 Length:383 Species:Arabidopsis thaliana


Alignment Length:194 Identity:41/194 - (21%)
Similarity:85/194 - (43%) Gaps:23/194 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VEKATSETNTNDNWSLILDVCDKVTTNPRLAKDCLKAVMRRMGHTDPHVVMQAITLLDALSNNCG 78
            |::||.||....||.:.:.:|.::..:.....:.::|:.|::....|.....::.||:|.:.||.
plant    42 VDEATLETLEEPNWGMNMRICAQINNDEFNGTEIVRAIKRKISGKSPVSQRLSLELLEACAMNCE 106

  Fly    79 KPLHLEVASRDFETEFRRLLAKAQPKVSLKMR--QVLKNWAENDYKNDRELDLIPAL---YAKLR 138
            | :..||||.....|...|:...:.....:.|  |:::.|.::     ::|..:|..   |..|.
plant   107 K-VFSEVASEKVLDEMVWLIKNGEADSENRKRAFQLIRAWGQS-----QDLTYLPVFHQTYMSLE 165

  Fly   139 QE------GYDFKNLGDKTSKTVAEKAAALPKD-----PNVVSSQQEEDDIAKAI-ELSLKENK 190
            .|      |.:....|..:.:::.::...:|..     ||...:..::|.:.... .||:|:.|
plant   166 GENGLHARGEENSMPGQSSLESLMQRPVPVPPPGSYPVPNQEQALGDDDGLDYNFGNLSIKDKK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StamNP_477448.1 VHS_STAM 10..154 CDD:239625 33/150 (22%)
SH3_STAM 235..288 CDD:212754
GAT 340..412 CDD:281166
AT1G06210NP_563762.1 VHS 39..164 CDD:340765 29/127 (23%)
GAT_GGA-like_plant 231..308 CDD:410579
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1213216at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.