DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stam and SH3GL3

DIOPT Version :9

Sequence 1:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_001311111.1 Gene:SH3GL3 / 6457 HGNCID:10832 Length:360 Species:Homo sapiens


Alignment Length:310 Identity:67/310 - (21%)
Similarity:113/310 - (36%) Gaps:63/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KLRQEGYDFKNLGDKTSKTVAEKAAALPKDPNVVSSQQE--EDDIAKAIELSLKENKGSPKTGSV 198
            ||..|..|.:...|.|:|.|||          ::|...|  :.:.|...:|.:. |..|...|.|
Human    28 KLDDEFLDMERKIDVTNKVVAE----------ILSKTTEYLQPNPAYRAKLGML-NTVSKIRGQV 81

  Fly   199 ASTGTASAYPSL----------YPSFAGTGSSAPSA-----EASSAPAPEPRKVRALYDFEAAEE 248
            .:||    ||..          |....|..|:..:|     |:....|    :|:...|....: 
Human    82 KTTG----YPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMA----EVKDSLDINVKQ- 137

  Fly   249 NELTFFAGEIIHVLDDSDPNWWKGYNQRGEGLFPSNFVTADLSVDPERLDINQQHKSAAAAGQRE 313
               ||.  :.:.:|.|.|......:.::.||               .|||.:.:.|........|
Human   138 ---TFI--DPLQLLQDKDLKEIGHHLKKLEG---------------RRLDYDYKKKRVGKIPDEE 182

  Fly   314 LDSAAALQQKTEAAAAAAAAQPVEIDESKIDRLLHLLHEANPEDPSQDSDEMLQLEQEVHQMGPL 378
            :..|....::::..|..:....:|.|..::.:|...:..|  .|..:.|.|:||..|...||...
Human   183 VRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAA--LDYHRQSTEILQELQSKLQMRIS 245

  Fly   379 IDAELERVDRKHAQLTQLSSDL--VDAINLYHT--LMRDDRAAAGHFAAA 424
            ..:.:.|.:.|...:.:.||:|  |...::..|  |....::..||...|
Human   246 AASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTGLRSKRKSTQGHLGRA 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StamNP_477448.1 VHS_STAM 10..154 CDD:239625 6/17 (35%)
SH3_STAM 235..288 CDD:212754 9/52 (17%)
GAT 340..412 CDD:281166 18/75 (24%)
SH3GL3NP_001311111.1 Membrane-binding amphipathic helix. /evidence=ECO:0000250 1..21
Required for dimerization upon membrane association. /evidence=ECO:0000250 60..87 8/31 (26%)
Interaction with ARC. /evidence=ECO:0000250 218..254 10/37 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..271 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.