DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stam and sh3gl1

DIOPT Version :9

Sequence 1:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_989126.1 Gene:sh3gl1 / 619364 XenbaseID:XB-GENE-951561 Length:366 Species:Xenopus tropicalis


Alignment Length:307 Identity:78/307 - (25%)
Similarity:128/307 - (41%) Gaps:61/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GIFGQSS-PFDADVEKATSETNTNDNWSLILDVCDKVTTNPRLA--KDCLKAVMRRMGHTDPHVV 63
            |:.|::. .|..|:   ..|:|..|   .:||..:.:   .|||  ||.|...:::         
 Frog    91 GVLGETMIKFGKDL---GDESNFGD---ALLDAGESM---KRLAEVKDSLDIEVKQ--------- 137

  Fly    64 MQAITLLDALSNNCGKPL-----HL-EVASRDFETEFRRLLAKAQPKV-SLKMRQVLKNWAENDY 121
                ..||.|.|.|.|.|     || ::..|..:.::::   |.|.|: ..::||.::.:.|:  
 Frog   138 ----NFLDPLQNLCDKDLKEIQHHLKKLEGRRLDYDYKK---KRQGKIPDEELRQAMEKFIES-- 193

  Fly   122 KNDRELDLIPALYAKLRQEGYDFKNLGDKTSKTVAEKAAALPKDPNVVS-----SQQEEDDIAKA 181
            |...|..:|..|...:.|           .|:..|...|.|......|.     |::.:|.:.::
 Frog   194 KEVAETSMINLLDTDVEQ-----------VSQLTALVEAQLDYHRQAVQILDELSEKLKDRVRES 247

  Fly   182 IELSLKENKGSPKTG-----SVASTGTASAYPSLYPSFAGTGSSAPSA--EASSAPAPEPRKVRA 239
            ...:.:|.|..|:..     |..|.|..|...|..|:.:...|..|:.  ..||||..:| ..:|
 Frog   248 SSRTKREFKPKPRESYEYAESEQSNGGFSNPSSKAPASSSFRSEKPARTNNRSSAPLDQP-CCKA 311

  Fly   240 LYDFEAAEENELTFFAGEIIHVLDDSDPNWWKGYNQRGEGLFPSNFV 286
            ||||:...:.||.|...:||.:.:..|.||::|......|.||.|:|
 Frog   312 LYDFDPENDGELGFRESDIITLTNQIDENWYEGMINGQSGFFPVNYV 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StamNP_477448.1 VHS_STAM 10..154 CDD:239625 35/152 (23%)
SH3_STAM 235..288 CDD:212754 19/52 (37%)
GAT 340..412 CDD:281166
sh3gl1NP_989126.1 BAR_Endophilin_A 25..246 CDD:153276 43/192 (22%)
SH3_Endophilin_A 307..361 CDD:212737 20/53 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.