DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Stam and wdfy2

DIOPT Version :9

Sequence 1:	NP_477448.1	Gene:	Stam / 34505	FlyBaseID:	FBgn0027363	Length:	689	Species:	Drosophila melanogaster
Sequence 2:	NP_991308.1	Gene:	wdfy2 / 492636	ZFINID:	ZDB-GENE-041111-211	Length:	400	Species:	Danio rerio

Alignment Length:	129	Identity:	28/129 - (21%)
Similarity:	52/129 - (40%)	Gaps:	44/129 - (34%)

- Green bases have known domain annotations that are detailed below.

  Fly   131 PALYAKLRQEGYDFKNLGDKTSKTVAEKAAALPKDPNVVSSQQEEDDIAKAIELSLKENKGSPKT 195
            |.|.:|:  ||:          :.|...|..:||:..|:|..|:     :.|.:.||.:.|
Zfish    14 PVLLSKI--EGF----------QDVVNTAVIIPKEDGVISVSQD-----RTIRVWLKRDSG---- 57

  Fly   196 GSVASTGTASAYPSLYPSFAGTGSSAPSAEASSAPAPEPRKVR------ALYDFEAAEE-NELT 252
                     ..:||:|       .:.|.|.:..:..||.|::.      .:.:|..:|: |::|
Zfish    58 ---------QYWPSVY-------HTMPVACSCMSFNPETRRISVGLENGTVSEFVLSEDYNQMT 105

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Stam	NP_477448.1	VHS_STAM	10..154	CDD:239625	5/22 (23%)
		SH3_STAM	235..288	CDD:212754	5/25 (20%)
		GAT	340..412	CDD:281166
wdfy2	NP_991308.1	WD40	16..272	CDD:295369	27/127 (21%)
		WD40	18..394	CDD:225201	26/125 (21%)
		WD40 repeat	28..64	CDD:293791	12/53 (23%)
		WD40 repeat	69..107	CDD:293791	8/37 (22%)
		WD40 repeat	117..154	CDD:293791
		WD40 repeat	159..197	CDD:293791
		WD40 repeat	202..239	CDD:293791
		WD40 repeat	246..303	CDD:293791
		FYVE_WDFY1_like	279..348	CDD:277258
		WD40 repeat	316..363	CDD:293791
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170574146
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930