DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stam and Src64B

DIOPT Version :10

Sequence 1:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster


Alignment Length:118 Identity:39/118 - (33%)
Similarity:57/118 - (48%) Gaps:10/118 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 LSLKENKGSPKTGSVASTGTASAY---PSLYPSFAGTGSSAPSAEASSAPAPE-PRKVRALYDFE 244
            |..|.|.|    ||:.|..|....   |.......|.....|....:..|... .|.|.||||::
  Fly    47 LGQKHNNG----GSLDSRYTPDPNHRGPLKIGGKGGVDIIRPRTTPTGVPGVVLKRVVVALYDYK 107

  Fly   245 AAEENELTFFAGEIIHVLDDSDPNWWKGYN--QRGEGLFPSNFVTADLSVDPE 295
            :.:|::|:|..|:.:.|:||::.:||:..|  .|.|||.|.|||..:.||:.|
  Fly   108 SRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StamNP_477448.1 VHS_STAM 10..141 CDD:340770
SH3_STAM 235..288 CDD:212754 24/54 (44%)
GAT_STAM 337..413 CDD:410593
PHA03247 <436..526 CDD:223021
Src64BNP_001286937.1 SH2_Src_family 158..259 CDD:199827 1/3 (33%)
PTKc_Src_like 289..538 CDD:270630
SH3_Src_like 99..150 CDD:212779 20/50 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.